1.67 Rating by CuteStat

livebetterfast.com is 1 decade 2 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, livebetterfast.com is SAFE to browse.

PageSpeed Score
90
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 1
H3 Headings: 6 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.6.1
Date: Sun, 10 Aug 2014 02:45:49 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 2267
Connection: keep-alive
X-Pingback: http://livebetterfast.com/xmlrpc.php
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip

Domain Information

Domain Registrar: DropCatch.com 1435 LLC
Registration Date: Jan 12, 2012, 12:00 AM 1 decade 2 years 4 months ago
Last Modified: Jul 29, 2014, 12:00 AM 9 years 9 months 2 weeks ago
Expiration Date: Jan 12, 2015, 12:00 AM 9 years 3 months 4 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns273.hostgator.com 192.254.234.252 United States of America United States of America
ns274.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
livebetterfast.com A 14395 IP: 192.254.234.33
livebetterfast.com NS 21599 Target: ns273.hostgator.com
livebetterfast.com NS 21599 Target: ns274.hostgator.com
livebetterfast.com SOA 21599 MNAME: ns6489.hostgator.com
RNAME: dnsadmin.gator3245.hostgator.com
Serial: 2014080700
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
livebetterfast.com MX 14399 Target: livebetterfast.com
livebetterfast.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: LIVEBETTERFAST.COM
Registry Domain ID: 1696664670_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2014-03-18 10:46:07Z
Creation Date: 2012-01-12 14:16:00Z
Registrar Registration Expiration Date: 2015-01-12 06:16:00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252744500
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: MARK DUIN
Registrant Organization: BUSINESS WITHOUT LIMITS
Registrant Street: 3349 SOUTH 114TH AVENUE
Registrant City: OMAHA
Registrant State/Province: NE
Registrant Postal Code: 68144
Registrant Country: US
Registrant Phone: +1.4023127989
Registrant Phone Ext:
Registrant Fax: 1.
Registrant Fax Ext:
Registrant Email: ADMIN@BUSINESSWITHOUTLIMITS.COM
Registry Admin ID:
Admin Name: ADAM FARRAR
Admin Organization: HOSTGATOR
Admin Street: 5005 MITCHELLDALE
Admin Street: SUITE #100
Admin City: HOUSTON
Admin State/Province: TX
Admin Postal Code: 77092
Admin Country: US
Admin Phone: +1.7135745287
Admin Phone Ext:
Admin Fax: +1.2814767800
Admin Fax Ext:
Admin Email: DOMAINS@HOSTGATOR.COM
Registry Tech ID:
Tech Name: ADAM FARRAR
Tech Organization: HOSTGATOR
Tech Street: 5005 MITCHELLDALE
Tech Street: SUITE #100
Tech City: HOUSTON
Tech State/Province: TX
Tech Postal Code: 77092
Tech Country: US
Tech Phone: +1.7135745287
Tech Phone Ext:
Tech Fax: +1.2814767800
Tech Fax Ext:
Tech Email: DOMAINS@HOSTGATOR.COM
Name Server: NS273.HOSTGATOR.COM
Name Server: NS274.HOSTGATOR.COM
DNSSEC: unSigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2014-03-18 10:46:07Z

The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.

We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002

Get Noticed on the Internet! Increase visibility for this domain name by listing it at www.whoisbusinesslistings.com